(data stored in ACNUC30630 zone)

EMBL: CP001096.PE129

CP001096.PE129       Location/Qualifiers
FT   CDS             complement(142414..143694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0129"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcs:BCAN_B1211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98691"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q703"
FT                   /protein_id="ACE98691.1"
FT                   /translation="MLKRWIAAAAMTLVAGIAHAQQQTEVVLQFPYPELFSETHKRIAE
FT                   EFAKVHPEIKVTFRAPYESYEEATQKVLREAVTNQLPDVTFQGLNRIRVLVDKTIPAPL
FT                   DGYIAAEKDFDKQGFHQAMYDIGTASGKVYALPFAISLPIVYVNLDLVKQAGGDVNNLP
FT                   TTWDGLLDLAKKVKALGPDTNGITYAWDITGNWLWQAPVFARGGTMLNADETKVAFDGP
FT                   EGQFAMRTIARLVTEGGMPNLDQPSMRATFAAGKTGIHITSTSDLKKTTDMIGGKFALK
FT                   TIAFPDVVKPNGRLPAGGNVVLITAKDKAKRDAAWEVVKFWTGPKGAAIMAETTGYMPP
FT                   NKVANDVYLKDFYAKNPNNYTAVSQLALLTKWYAFPGDNGLKITDVIKDHLNSIVSGAR
FT                   AKEPDAVLADMTRDVQNLLPKTVGAAK"
     MLKRWIAAAA MTLVAGIAHA QQQTEVVLQF PYPELFSETH KRIAEEFAKV HPEIKVTFRA        60
     PYESYEEATQ KVLREAVTNQ LPDVTFQGLN RIRVLVDKTI PAPLDGYIAA EKDFDKQGFH       120
     QAMYDIGTAS GKVYALPFAI SLPIVYVNLD LVKQAGGDVN NLPTTWDGLL DLAKKVKALG       180
     PDTNGITYAW DITGNWLWQA PVFARGGTML NADETKVAFD GPEGQFAMRT IARLVTEGGM       240
     PNLDQPSMRA TFAAGKTGIH ITSTSDLKKT TDMIGGKFAL KTIAFPDVVK PNGRLPAGGN       300
     VVLITAKDKA KRDAAWEVVK FWTGPKGAAI MAETTGYMPP NKVANDVYLK DFYAKNPNNY       360
     TAVSQLALLT KWYAFPGDNG LKITDVIKDH LNSIVSGARA KEPDAVLADM TRDVQNLLPK       420
     TVGAAK                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page