(data stored in ACNUC30630 zone)

EMBL: CP001096.PE133

CP001096.PE133       Location/Qualifiers
FT   CDS             146784..147662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0133"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sme:SMb21535 putative
FT                   transcriptional regulator, LysR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98695"
FT                   /db_xref="GOA:B3Q707"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q707"
FT                   /protein_id="ACE98695.1"
FT                   /translation="MALTSARVRAVNAVFDAGSFAAAARRIGVTQSAVAQSVRELEGEF
FT                   GVTLFERHGANLIPTSLCRQLYGATSRMQAVETDALSILSQREELAGGELRVGLGNSMP
FT                   GMALIATFKQMYPKVQVAIEIGSWSAIVAAVVDQRVDIGVLPDVPADRRFRREICLEQR
FT                   VVALCHPSHPLKKKQQVPIAELMRYPLVFRTRDSSTQRAVDRAFRAASLRPIPSIVVNT
FT                   REGMLEAVANHLGVGFMWEHGSSRVDRIAKVPIAELDAESPECIFALAGKKGRLVELFF
FT                   LANGAHSPPRE"
     MALTSARVRA VNAVFDAGSF AAAARRIGVT QSAVAQSVRE LEGEFGVTLF ERHGANLIPT        60
     SLCRQLYGAT SRMQAVETDA LSILSQREEL AGGELRVGLG NSMPGMALIA TFKQMYPKVQ       120
     VAIEIGSWSA IVAAVVDQRV DIGVLPDVPA DRRFRREICL EQRVVALCHP SHPLKKKQQV       180
     PIAELMRYPL VFRTRDSSTQ RAVDRAFRAA SLRPIPSIVV NTREGMLEAV ANHLGVGFMW       240
     EHGSSRVDRI AKVPIAELDA ESPECIFALA GKKGRLVELF FLANGAHSPP RE               292
//

If you have problems or comments...

PBIL Back to PBIL home page