(data stored in ACNUC30630 zone)

EMBL: CP001096.PE136

CP001096.PE136       Location/Qualifiers
FT   CDS             complement(149123..150115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0136"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: sth:STH760 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98698"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q710"
FT                   /protein_id="ACE98698.1"
FT                   /translation="MSPPQHLIPTRRDVVRGLAALPALGLTRTFAAEPLTLWGIPATPS
FT                   ALFVRAVASEQLQQAAPGIRFQLWKSTDQMRAGIASGQFRLFATSTYAAANFFNRGAGT
FT                   RMLNVVTWGVLYVMARDPAIRSVADLAGRSILLSNKNEAPDLLFRLVLRWAGLDPDRDV
FT                   RCEYVGSPGEAVPLFLAGRSDVAVLHEPAATTALLRAKQEGKPVYRVLDIAELYGRHAG
FT                   RGPRIPQVGLAVSADLLDTQPGLVAAVQAACVEASTWIAAHPAEAAELAAPALGLPAEV
FT                   IAASLPHVRLDVVPARQARDDIEMYFKNLMELDPGIVGGRLPDAAFYAG"
     MSPPQHLIPT RRDVVRGLAA LPALGLTRTF AAEPLTLWGI PATPSALFVR AVASEQLQQA        60
     APGIRFQLWK STDQMRAGIA SGQFRLFATS TYAAANFFNR GAGTRMLNVV TWGVLYVMAR       120
     DPAIRSVADL AGRSILLSNK NEAPDLLFRL VLRWAGLDPD RDVRCEYVGS PGEAVPLFLA       180
     GRSDVAVLHE PAATTALLRA KQEGKPVYRV LDIAELYGRH AGRGPRIPQV GLAVSADLLD       240
     TQPGLVAAVQ AACVEASTWI AAHPAEAAEL AAPALGLPAE VIAASLPHVR LDVVPARQAR       300
     DDIEMYFKNL MELDPGIVGG RLPDAAFYAG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page