(data stored in ACNUC30630 zone)

EMBL: CP001096.PE137

CP001096.PE137       Location/Qualifiers
FT   CDS             complement(150131..151990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0137"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: ferredoxin;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; iron
FT                   hydrogenase small subunit; hydrogenase large subunit domain
FT                   protein; KEGG: dvu:DVU1771 [Fe] hydrogenase gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98699"
FT                   /db_xref="GOA:B3Q711"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q711"
FT                   /protein_id="ACE98699.1"
FT                   /translation="MCTPDQASLSARDPAEATITLSINGVACAGFANETILSCARRYDV
FT                   YIPTLCELEDIDHTPGACRVCLVEILQAGKDTPQIVTACNTPVRDGMEVQTRSKKARDM
FT                   QRLQVELLMADHLQDCATCIRHGSCELQDLAQFVGLQQNRFFDRERTESRPVDHSSPSM
FT                   VRDMRRCVRCQRCVAICRYHQKIDALAIEGSGLERMVALRDADGYPNSVCVSCGQCVLV
FT                   CPTGALGERDETDRALDYICDPEVVTVVQFAPAVRVAFGEEFGLPAGTNVEGQIIAACR
FT                   KLGVDVVLDTNFAADVVIMEEGAELLARLKQGRRPTFTSCCPAWINFAEIHYPDVLPLL
FT                   SSTKSPQQVLSTIAKSYLPAQLGVPAERIRVISIMPCIAKKDEAVRPQMVHDGQPETDL
FT                   VLTTREFARLLRREGIDLKDLPSSQFDRPFLSAYSGAGAIFGTTGGVMEAAVRTIYALV
FT                   NGRELDRIELTQLRGFEGLREATVDLGGPVGEVKVAMVHGLGDTRRLVESVLSGEANYD
FT                   FIEVMACPGGCVDGGGSLRSKKAYLPLALKRRETIYNVDRAAKVRQSHNNPQVQVLYRE
FT                   LLQAPNSEIAHRLLHTHYASRKRELQHTVKEIWDDLTMSTILY"
     MCTPDQASLS ARDPAEATIT LSINGVACAG FANETILSCA RRYDVYIPTL CELEDIDHTP        60
     GACRVCLVEI LQAGKDTPQI VTACNTPVRD GMEVQTRSKK ARDMQRLQVE LLMADHLQDC       120
     ATCIRHGSCE LQDLAQFVGL QQNRFFDRER TESRPVDHSS PSMVRDMRRC VRCQRCVAIC       180
     RYHQKIDALA IEGSGLERMV ALRDADGYPN SVCVSCGQCV LVCPTGALGE RDETDRALDY       240
     ICDPEVVTVV QFAPAVRVAF GEEFGLPAGT NVEGQIIAAC RKLGVDVVLD TNFAADVVIM       300
     EEGAELLARL KQGRRPTFTS CCPAWINFAE IHYPDVLPLL SSTKSPQQVL STIAKSYLPA       360
     QLGVPAERIR VISIMPCIAK KDEAVRPQMV HDGQPETDLV LTTREFARLL RREGIDLKDL       420
     PSSQFDRPFL SAYSGAGAIF GTTGGVMEAA VRTIYALVNG RELDRIELTQ LRGFEGLREA       480
     TVDLGGPVGE VKVAMVHGLG DTRRLVESVL SGEANYDFIE VMACPGGCVD GGGSLRSKKA       540
     YLPLALKRRE TIYNVDRAAK VRQSHNNPQV QVLYRELLQA PNSEIAHRLL HTHYASRKRE       600
     LQHTVKEIWD DLTMSTILY                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page