(data stored in ACNUC30630 zone)

EMBL: CP001096.PE144

CP001096.PE144       Location/Qualifiers
FT   CDS             complement(160802..161272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0144"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bja:blr2344
FT                   probable chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98706"
FT                   /db_xref="GOA:B3Q718"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q718"
FT                   /protein_id="ACE98706.1"
FT                   /translation="MSSDRVQGATDGDADAMQVVMIGLGDEKFAIDAGLVREIIDPIPA
FT                   TKVAGAKAFVPGVINVRGNVIPFADLRIRFGMPVQTHTADSRIVVLEVRLDNEAVLVGV
FT                   SADRVYEVTEISRTDVQQTPRVGMHWKPEYIRFITKWRDEFVVVPNMERILN"
     MSSDRVQGAT DGDADAMQVV MIGLGDEKFA IDAGLVREII DPIPATKVAG AKAFVPGVIN        60
     VRGNVIPFAD LRIRFGMPVQ THTADSRIVV LEVRLDNEAV LVGVSADRVY EVTEISRTDV       120
     QQTPRVGMHW KPEYIRFITK WRDEFVVVPN MERILN                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page