(data stored in ACNUC30630 zone)

EMBL: CP001096.PE149

CP001096.PE149       Location/Qualifiers
FT   CDS             complement(165638..165820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98711"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q723"
FT                   /protein_id="ACE98711.1"
FT                   /translation="MNQFKLGDEVCKDNGRRGVVRAIFVNREAARMCAVEINGALDFIE
FT                   ESRLSPQQQRADLAA"
     MNQFKLGDEV CKDNGRRGVV RAIFVNREAA RMCAVEINGA LDFIEESRLS PQQQRADLAA        60
//

If you have problems or comments...

PBIL Back to PBIL home page