(data stored in ACNUC30630 zone)

EMBL: CP001096.PE150

CP001096.PE150       Location/Qualifiers
FT   CDS             complement(166287..167450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0150"
FT                   /product="conserved hypothetical protein; putative
FT                   glucokinase"
FT                   /note="KEGG: bra:BRADO0437 conserved hypothetical protein;
FT                   putative glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98712"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q724"
FT                   /protein_id="ACE98712.1"
FT                   /translation="MAEDSLTTTNAGIAAHGATRLPSVEIDSYNIEIKDEDGFLGDRAS
FT                   KGAFQRLLDDWRKALRETGDDPFGRRDTKNIAKSALDEVLTSDDVAAAAVVHSAIEDFA
FT                   QELAYVTKRFLRTKAWAETECIVVGGGFRQSRVGELAIARTDILLKADGHAVDLVPIRF
FT                   HPDEAGLIGCLHLAPSWIFEAHDSILAVDIGGSNIRCGVVETAWKKAPDLSKASVWKSD
FT                   LWRHADDEPTREGAVKRLTRMLKDLISEAEDEGFKLAPFIGISCPGVINADGSIEKGAQ
FT                   NLPGNWESSKFHLPRSLLEGIPTIGSHDTAILMHNDGVAQGLSEVPFMQEFERWGVLTI
FT                   GTGLGNARFTNRRDKDKAKKEREKDKEKDKEKDKEKGKKDKDSKEKA"
     MAEDSLTTTN AGIAAHGATR LPSVEIDSYN IEIKDEDGFL GDRASKGAFQ RLLDDWRKAL        60
     RETGDDPFGR RDTKNIAKSA LDEVLTSDDV AAAAVVHSAI EDFAQELAYV TKRFLRTKAW       120
     AETECIVVGG GFRQSRVGEL AIARTDILLK ADGHAVDLVP IRFHPDEAGL IGCLHLAPSW       180
     IFEAHDSILA VDIGGSNIRC GVVETAWKKA PDLSKASVWK SDLWRHADDE PTREGAVKRL       240
     TRMLKDLISE AEDEGFKLAP FIGISCPGVI NADGSIEKGA QNLPGNWESS KFHLPRSLLE       300
     GIPTIGSHDT AILMHNDGVA QGLSEVPFMQ EFERWGVLTI GTGLGNARFT NRRDKDKAKK       360
     EREKDKEKDK EKDKEKGKKD KDSKEKA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page