(data stored in ACNUC30630 zone)

EMBL: CP001096.PE155

CP001096.PE155       Location/Qualifiers
FT   CDS             169782..169955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98717"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q729"
FT                   /protein_id="ACE98717.1"
FT                   /translation="MSDSPDQAVAVRDVRDEFRADLDAFEATERKLLIEERRERARVLS
FT                   ERFSGLALRVGE"
     MSDSPDQAVA VRDVRDEFRA DLDAFEATER KLLIEERRER ARVLSERFSG LALRVGE           57
//

If you have problems or comments...

PBIL Back to PBIL home page