(data stored in ACNUC30630 zone)

EMBL: CP001096.PE158

CP001096.PE158       Location/Qualifiers
FT   CDS             172213..173343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0158"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: bbt:BBta_0422 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98720"
FT                   /db_xref="GOA:B3Q732"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q732"
FT                   /protein_id="ACE98720.1"
FT                   /translation="MASPKLHDFRHIVVKVGSSLLIDSAAGEVRAGWLAALAADIAELH
FT                   RGGRDVMVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIELARTWSEVLGAHGIGA
FT                   GQILVTFQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATTEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGNDPDATLIPVVEAITAEIEGMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLRAIAEGGKCTWFLTPANPVTARKRWIAGTLEPK
FT                   GTLTIDAGAVSALRAGKSLLPAGVIRVDGQFSRGDAVIVRGPDTHEIGRGLVAYDAEDA
FT                   EKIKGHSSPDVMMILGITGRAEMIHRDDLVVGTAPT"
     MASPKLHDFR HIVVKVGSSL LIDSAAGEVR AGWLAALAAD IAELHRGGRD VMVVSSGSIA        60
     LGRSRLKLPR GPLKLEESQA AAAVGQIELA RTWSEVLGAH GIGAGQILVT FQDTEERRRY       120
     LNARSTIAKL LEWRAVPVIN ENDTVATTEI RYGDNDRLAA RVATMASADL LILLSDIDGL       180
     YTAPPGNDPD ATLIPVVEAI TAEIEGMAGA AGSELSRGGM RTKIEAAKIA TSAGTHMLIA       240
     SGKIDHPLRA IAEGGKCTWF LTPANPVTAR KRWIAGTLEP KGTLTIDAGA VSALRAGKSL       300
     LPAGVIRVDG QFSRGDAVIV RGPDTHEIGR GLVAYDAEDA EKIKGHSSPD VMMILGITGR       360
     AEMIHRDDLV VGTAPT                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page