(data stored in ACNUC30630 zone)

EMBL: CP001096.PE162

CP001096.PE162       Location/Qualifiers
FT   CDS             176250..176732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0162"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   nha:Nham_0523 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98724"
FT                   /db_xref="GOA:B3Q736"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q736"
FT                   /protein_id="ACE98724.1"
FT                   /translation="MRLLILAVGKLKQGPERELAERYRARFDDLGRKLGFRGLDVHEIA
FT                   ESRAREAPARMAEEAAAIIAQVQDGAVLVTLDERGQSLGSTAFAAQLGRWRDEQVPGTI
FT                   FVIGGADGLLPELRRKAKLSMSFGGATWPHQMVRVMLLEQIYRAATILAGHPYHRA"
     MRLLILAVGK LKQGPERELA ERYRARFDDL GRKLGFRGLD VHEIAESRAR EAPARMAEEA        60
     AAIIAQVQDG AVLVTLDERG QSLGSTAFAA QLGRWRDEQV PGTIFVIGGA DGLLPELRRK       120
     AKLSMSFGGA TWPHQMVRVM LLEQIYRAAT ILAGHPYHRA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page