(data stored in ACNUC30630 zone)

EMBL: CP001096.PE164

CP001096.PE164       Location/Qualifiers
FT   CDS             178140..179516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0164"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: bja:blr0434 carboxy-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98726"
FT                   /db_xref="GOA:B3Q738"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q738"
FT                   /protein_id="ACE98726.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRTMLMGATARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLVESAISGMLAGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGILANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDNPIEVTLVRDNIRVRSVRARVEDSDIGYIRITTFNEQTTEGLKKE
FT                   IANLTNQIGADKLKGFILDLRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRS
FT                   AHAGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATVVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQAKGITPDIEVMQDVPADLKARTDTKGEASLRGHLKGADG
FT                   DEKTGSQSYVPPEAKDDKALKAAADLLHGIKVNASAPADKQTTGDKAAIDKPAGNKAAN
FT                   "
     MMRKTSVILL SAVTGAALTL FVTQPRTMLM GATARAATSD TYRQLNLFGD VFERVRSDYV        60
     EKPDDSKLVE SAISGMLAGL DPHSSYMDAK SFRDMQVQTR GEFGGLGIEV TMEDGLIKVV       120
     SPIDDTPASK AGILANDIIT NLDDEAVQGL TLNQAVEKMR GPVNTKIRLK IVRKGQDNPI       180
     EVTLVRDNIR VRSVRARVED SDIGYIRITT FNEQTTEGLK KEIANLTNQI GADKLKGFIL       240
     DLRNNPGGLL EEAVTVSDAF LDRGEIVSTR GRNAEETQRR SAHAGDLTKG KPVIVLINGG       300
     SASASEIVAG ALQDHKRATV VGTRSFGKGS VQTIIPLGSG NGALRLTTAR YYTPSGKSIQ       360
     AKGITPDIEV MQDVPADLKA RTDTKGEASL RGHLKGADGD EKTGSQSYVP PEAKDDKALK       420
     AAADLLHGIK VNASAPADKQ TTGDKAAIDK PAGNKAAN                               458
//

If you have problems or comments...

PBIL Back to PBIL home page