(data stored in ACNUC30630 zone)

EMBL: CP001096.PE171

CP001096.PE171       Location/Qualifiers
FT   CDS             complement(185139..186569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0171"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: nha:Nham_0529 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98733"
FT                   /db_xref="GOA:B3Q745"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q745"
FT                   /protein_id="ACE98733.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGRIMNVIGEPVDEQG
FT                   PIKSEGLRAIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVARAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVGLTGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSASIVGEEHYNTARMVQQILQKYKSLQDIIAILGMDELSEEDK
FT                   LTVARARKIERFLSQPFFVAEVFTGSPGKFVDLADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GTIEEAVEKGKKLAAEAA"
     MATPANQTGR ITQVIGAVVD VQFEGHLPAI LNAIETKNGD NRLVLEVAQH LGESTVRTIA        60
     MDTTEGLVRG QEVTDTGAPI SVPVGAGTLG RIMNVIGEPV DEQGPIKSEG LRAIHQEAPA       120
     YTDQSTEAEI LVTGIKVVDL LAPYAKGGKI GLFGGAGVGK TVLIQELINN VARAHGGYSV       180
     FAGVGERTRE GNDLYHEFIE SGVNKKGGGE GSKCALVYGQ MNEPPGARAR VGLTGLTVAE       240
     HFRDQGQDVL FFVDNIFRFT QAGSEVSALL GRIPSAVGYQ PTLATDMGAL QERITTTTKG       300
     SITSVQAIYV PADDLTDPAP ATSFAHLDAT TVLNRAISEK GIYPAVDPLD STSRMLSASI       360
     VGEEHYNTAR MVQQILQKYK SLQDIIAILG MDELSEEDKL TVARARKIER FLSQPFFVAE       420
     VFTGSPGKFV DLADTIKGFR AICEGKYDHL PEAAFYMVGT IEEAVEKGKK LAAEAA           476
//

If you have problems or comments...

PBIL Back to PBIL home page