(data stored in ACNUC30630 zone)

EMBL: CP001096.PE172

CP001096.PE172       Location/Qualifiers
FT   CDS             complement(186641..187516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0172"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: nha:Nham_0531 F0F1 ATP synthase subunit gamma;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98734"
FT                   /db_xref="GOA:B3Q746"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q746"
FT                   /protein_id="ACE98734.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPY
FT                   AEKMEAVISNIAGAAAGSPGAPVLLAGNGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RAYELMSQGKTVKFFCVGRKGYEQLRRNFEKQIIDNVELRSVRQIGFVNAEDIAKKVIA
FT                   RFNAGEFDVCTLFYSRFKSVISQIPTAQQLIPLEVTAPAAGTVATSYEYEPEEDEILSG
FT                   LLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAMITKEL
FT                   IEIISGAEAI"
     MASLKDMRVR IASTKATQKI TKAMQMVAAS KLRRAQMAAE AARPYAEKME AVISNIAGAA        60
     AGSPGAPVLL AGNGKDQVHL LLVCTGERGL SGAFNSSIVR LARERAYELM SQGKTVKFFC       120
     VGRKGYEQLR RNFEKQIIDN VELRSVRQIG FVNAEDIAKK VIARFNAGEF DVCTLFYSRF       180
     KSVISQIPTA QQLIPLEVTA PAAGTVATSY EYEPEEDEIL SGLLPRNLAV QIFRALLENN       240
     ASFYGAQMSA MDNATRNAGE MIRKQTLVYN RTRQAMITKE LIEIISGAEA I                291
//

If you have problems or comments...

PBIL Back to PBIL home page