(data stored in ACNUC30630 zone)

EMBL: CP001096.PE177

CP001096.PE177       Location/Qualifiers
FT   CDS             193494..194465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0177"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bja:blr0446 site-specific
FT                   tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98739"
FT                   /db_xref="GOA:B3Q751"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q751"
FT                   /protein_id="ACE98739.1"
FT                   /translation="MAPSKSAPPPLELSCAAADLTAEMTKWLSHLRAERRLSGKTLEAY
FT                   ARDVRQFLQFLAEHWGGEVTLGRFARLEATDVRAFMAARRADEIAGRSLMRALAGMRSF
FT                   GRFLEREGKGRVGALASVRAPKIKKSLPKPLPIAAAKRLADADERAGEERETWVLIRDA
FT                   AVMALLYGSGLRISEALGLKRRDVPAAGKGDTLIVHGKGNKTRMVPVLQNVLAQIAEYA
FT                   AACPYNLPPDGPMFVGARGGPLSPRIIQLAMERLRGGLGLPDSATPHALRHSFATHLLS
FT                   RGGDLRAIQELLGHASLSTTQVYTGIDTERLLEVYNSAHPRA"
     MAPSKSAPPP LELSCAAADL TAEMTKWLSH LRAERRLSGK TLEAYARDVR QFLQFLAEHW        60
     GGEVTLGRFA RLEATDVRAF MAARRADEIA GRSLMRALAG MRSFGRFLER EGKGRVGALA       120
     SVRAPKIKKS LPKPLPIAAA KRLADADERA GEERETWVLI RDAAVMALLY GSGLRISEAL       180
     GLKRRDVPAA GKGDTLIVHG KGNKTRMVPV LQNVLAQIAE YAAACPYNLP PDGPMFVGAR       240
     GGPLSPRIIQ LAMERLRGGL GLPDSATPHA LRHSFATHLL SRGGDLRAIQ ELLGHASLST       300
     TQVYTGIDTE RLLEVYNSAH PRA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page