(data stored in ACNUC30630 zone)

EMBL: CP001096.PE180

CP001096.PE180       Location/Qualifiers
FT   CDS             complement(195842..197245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0180"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   FAD dependent oxidoreductase; KEGG: bja:bll0449
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98742"
FT                   /db_xref="GOA:B3Q754"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q754"
FT                   /protein_id="ACE98742.1"
FT                   /translation="MATYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIGVPAPKLDLPAMMNFKQQGIDGNVKGVEYLMK
FT                   KNKIDVLVGKGKILGTGKVEVTGADGKASSVDTKSIVIASGSAVAQLKGIEIDEKRVVS
FT                   STGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQ
FT                   RILEKQGFAFKLGAKVTGVDTSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGL
FT                   GLKEAGVALDERGRVVIDDHFATSLKGVYAIGDVVRGPMLAHKAEDEGVAVAELIAGKA
FT                   GHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGVHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAIKEAAL
FT                   TVGKRAIHM"
     MATYDLVVIG TGPGGYVCAI RAAQLGLKVA VVEKNATLGG TCLNVGCMPS KALLHASELF        60
     EEAGHSFAKM GIGVPAPKLD LPAMMNFKQQ GIDGNVKGVE YLMKKNKIDV LVGKGKILGT       120
     GKVEVTGADG KASSVDTKSI VIASGSAVAQ LKGIEIDEKR VVSSTGALSL DKVPGKLIVV       180
     GAGVIGLELG SVWRRLGAEV TVVEFLDRIL PGMDGEVVKQ FQRILEKQGF AFKLGAKVTG       240
     VDTSGAKLAV KVEAAAGGNP ETLEADVVLV AIGRVPYTEG LGLKEAGVAL DERGRVVIDD       300
     HFATSLKGVY AIGDVVRGPM LAHKAEDEGV AVAELIAGKA GHVNYDVIPG VVYTTPEVSS       360
     VGKTEEDLKQ AGVAYTVGKF PFTANGRSKV NQTTDGFVKI LADAKTDRVL GVHIIGREAG       420
     EMIHEAAVLM EFGGSAEDLA RTCHAHPTRS EAIKEAALTV GKRAIHM                     467
//

If you have problems or comments...

PBIL Back to PBIL home page