(data stored in ACNUC30630 zone)

EMBL: CP001096.PE181

CP001096.PE181       Location/Qualifiers
FT   CDS             complement(197277..198023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0181"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbt:BBta_0397 putative oxidoreductase
FT                   (YgfF), NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98743"
FT                   /db_xref="GOA:B3Q755"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q755"
FT                   /protein_id="ACE98743.1"
FT                   /translation="MNDRVVIITGGSRGIGRATALGCAKRGFKVVVGYASNAAAADEVV
FT                   AEIAASNGKAIAVKCDVGSEADILALFAAADAFGPLGALVNNAGIVGPTARVDEMSAER
FT                   IQRMMAVNVTGSILCAREAVKRMSTRHGGKGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   VDSFTVGLGHEVAGEGIRVAAIRPGLIDTEIHASGGDPERAHRLSVNVPMKRVGRAEEI
FT                   ANAVVWLLSDEASYVTSAIIDVSGGR"
     MNDRVVIITG GSRGIGRATA LGCAKRGFKV VVGYASNAAA ADEVVAEIAA SNGKAIAVKC        60
     DVGSEADILA LFAAADAFGP LGALVNNAGI VGPTARVDEM SAERIQRMMA VNVTGSILCA       120
     REAVKRMSTR HGGKGGVIVN LSSVAAKLGS PNTYVDYAAS KGAVDSFTVG LGHEVAGEGI       180
     RVAAIRPGLI DTEIHASGGD PERAHRLSVN VPMKRVGRAE EIANAVVWLL SDEASYVTSA       240
     IIDVSGGR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page