(data stored in ACNUC30630 zone)

EMBL: CP001096.PE184

CP001096.PE184       Location/Qualifiers
FT   CDS             complement(199849..202806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0184"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit;
FT                   PFAM: dehydrogenase E1 component; Transketolase central
FT                   region; KEGG: bbt:BBta_0395 alpha-ketoglutarate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98746"
FT                   /db_xref="GOA:B3Q758"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q758"
FT                   /protein_id="ACE98746.1"
FT                   /translation="MSRQDANAAFALSSFLQGANATYIDDLYSRYESDPSSVDADWQAF
FT                   FRSLKDAPGDIQKNAEGPSWEQANWPLTPRDELTSALDGNWNQVEKAVGQKIQAKAQSR
FT                   GVELSSADVLQATRDSVRALMLIRAYRMRGHFHAKLDPLGLSPAKDHEELDIRSYGFTE
FT                   ADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTMGIEFLHISNGAQKAWIQERIEGPD
FT                   KEISFTREGRRAILMKLIESEGFEKFCDLKFTGTKRFGLDGGEALIPALEQIIKRGGNL
FT                   GVREIVLGMPHRGRLNVLTQVMAKAHRALFHEFKGGSANPDEVEGSGDVKYHLGASSDR
FT                   EFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERISVLPLLMHGDAAFAG
FT                   QGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKIAVEYRQKFHKPVVIDMFCYRRHGHNEGDEPSFTQPLMYRKIAGHP
FT                   TTLEIYSKRLIADGVITEGEVEKARADWRARLDAEFEAASSYRPNKADWLDGKWAGFKS
FT                   ADQEEEPRRGITGVDLPTLKEIGRRITKVPEGFRLHRTVQRFLENRARAIDSGNGLDWA
FT                   TGEALAFCTMLLEGHRIRLSGQDSERGTFSQRHSVLIDQEDETRYTPFNHLSPDQGHYE
FT                   VINSLLSEEAVLGFEYGYSLAEPNALTLWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFHALRRQLKREIRK
FT                   PLILMTPKSLLRHKRAISRLEELGPDTSFHRVLLDDAQTLPDDKTKLVADAKIRRVVVC
FT                   SGKVYYDLYDEREKRGIDDVYLLRVEQLYPVPVKTLVHELSRFKDAELVWCQEEPRNMG
FT                   GWHFIEPYLEWVQNQIEAKHRRPRYVGRAASAATATGLMSKHLAQLKAFLDEALR"
     MSRQDANAAF ALSSFLQGAN ATYIDDLYSR YESDPSSVDA DWQAFFRSLK DAPGDIQKNA        60
     EGPSWEQANW PLTPRDELTS ALDGNWNQVE KAVGQKIQAK AQSRGVELSS ADVLQATRDS       120
     VRALMLIRAY RMRGHFHAKL DPLGLSPAKD HEELDIRSYG FTEADLDRKI FLDHVLGLEY       180
     GSLREIVAIC ERTYCQTMGI EFLHISNGAQ KAWIQERIEG PDKEISFTRE GRRAILMKLI       240
     ESEGFEKFCD LKFTGTKRFG LDGGEALIPA LEQIIKRGGN LGVREIVLGM PHRGRLNVLT       300
     QVMAKAHRAL FHEFKGGSAN PDEVEGSGDV KYHLGASSDR EFDHNKVHLS LTANPSHLEI       360
     VDPVVLGKVR AKQDQHGDLP EERISVLPLL MHGDAAFAGQ GVVAECFALS DLKGYRTGGS       420
     IHFIVNNQIG FTTYPRYSRS SPYPSDVAKM IDAPIFHVNG DDPEAVVFAA KIAVEYRQKF       480
     HKPVVIDMFC YRRHGHNEGD EPSFTQPLMY RKIAGHPTTL EIYSKRLIAD GVITEGEVEK       540
     ARADWRARLD AEFEAASSYR PNKADWLDGK WAGFKSADQE EEPRRGITGV DLPTLKEIGR       600
     RITKVPEGFR LHRTVQRFLE NRARAIDSGN GLDWATGEAL AFCTMLLEGH RIRLSGQDSE       660
     RGTFSQRHSV LIDQEDETRY TPFNHLSPDQ GHYEVINSLL SEEAVLGFEY GYSLAEPNAL       720
     TLWEAQFGDF ANGAQVLFDQ FISSGERKWL RMSGLVCLLP HGYEGQGPEH SSARLERYLQ       780
     MCAEDNMQVV YPTTPANYFH ALRRQLKREI RKPLILMTPK SLLRHKRAIS RLEELGPDTS       840
     FHRVLLDDAQ TLPDDKTKLV ADAKIRRVVV CSGKVYYDLY DEREKRGIDD VYLLRVEQLY       900
     PVPVKTLVHE LSRFKDAELV WCQEEPRNMG GWHFIEPYLE WVQNQIEAKH RRPRYVGRAA       960
     SAATATGLMS KHLAQLKAFL DEALR                                             985
//

If you have problems or comments...

PBIL Back to PBIL home page