(data stored in ACNUC30630 zone)

EMBL: CP001096.PE19

CP001096.PE19        Location/Qualifiers
FT   CDS             complement(19622..20356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0019"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase mono-heme subunit/FixO;
FT                   KEGG: bbt:BBta_2793 cytochrome-c oxidase FixO chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98581"
FT                   /db_xref="GOA:B3QK17"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK17"
FT                   /protein_id="ACE98581.1"
FT                   /translation="MSIWARHKIFETNSVVLIVGILLVIAIGGLVEITPLFYLKSTIEK
FT                   VDGVRPYTPLELAGRNIYIREGCYLCHSQMIRPLRDEIERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGGKYSDDWHVAHLKNPRSIVPQSVMPNYAFLADNKVDVASLSDHLKTN
FT                   RTLGVPYSDEDIAKAAADAKAQVDPEGAAAADLQKRYPKAVVRNFDGQPGDPTELDALV
FT                   SYLQMLGTLVDFKLYDEKANLR"
     MSIWARHKIF ETNSVVLIVG ILLVIAIGGL VEITPLFYLK STIEKVDGVR PYTPLELAGR        60
     NIYIREGCYL CHSQMIRPLR DEIERYGHYS LAAESMYDHP FQWGSKRTGP DLARVGGKYS       120
     DDWHVAHLKN PRSIVPQSVM PNYAFLADNK VDVASLSDHL KTNRTLGVPY SDEDIAKAAA       180
     DAKAQVDPEG AAAADLQKRY PKAVVRNFDG QPGDPTELDA LVSYLQMLGT LVDFKLYDEK       240
     ANLR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page