(data stored in ACNUC30630 zone)

EMBL: CP001096.PE199

CP001096.PE199       Location/Qualifiers
FT   CDS             221675..222343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0201"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   bja:blr0468 heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98761"
FT                   /db_xref="GOA:B3Q773"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q773"
FT                   /protein_id="ACE98761.1"
FT                   /translation="MTALGAIIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLKRLGPAILWLGALLASLLTLDRLFTADAEDGSLDLIVMSRTPLELTCAAKALAHWLA
FT                   AGLPLIVATPVLGLLLNLDGSASLAVMATLLAGTPALTFTGMIGAALAVALRRGGLLLA
FT                   VLVLPLSIPVLIFGVSASQAAIVGPVSFGTPFSILCAISLLSLVIGPFAAAASLRQGLD
FT                   "
     MTALGAIIRR DIRIALRVGG GALIGVLFFL TVVVLMPFAV GPDLALLKRL GPAILWLGAL        60
     LASLLTLDRL FTADAEDGSL DLIVMSRTPL ELTCAAKALA HWLAAGLPLI VATPVLGLLL       120
     NLDGSASLAV MATLLAGTPA LTFTGMIGAA LAVALRRGGL LLAVLVLPLS IPVLIFGVSA       180
     SQAAIVGPVS FGTPFSILCA ISLLSLVIGP FAAAASLRQG LD                          222
//

If you have problems or comments...

PBIL Back to PBIL home page