(data stored in ACNUC30630 zone)

EMBL: CP001096.PE202

CP001096.PE202       Location/Qualifiers
FT   CDS             223360..223956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0204"
FT                   /product="periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: bja:blr0471
FT                   thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98764"
FT                   /db_xref="GOA:B3Q776"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q776"
FT                   /protein_id="ACE98764.1"
FT                   /translation="MSDTFDPASPKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPS
FT                   ALIGRPAPQTPLPPLDGLSRDGSQVAGLDPAMFKGKVSVVNVWASWCVPCHDEAPLLMT
FT                   LAQDTRIQLVGIDYKDKPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETFVIG
FT                   RDGKIAYKLVGPITPDNIEKVLKPEISKALAAPQS"
     MSDTFDPASP KRRSWLVVLP ALLFAGLAVL FWFRLGDSDV SRIPSALIGR PAPQTPLPPL        60
     DGLSRDGSQV AGLDPAMFKG KVSVVNVWAS WCVPCHDEAP LLMTLAQDTR IQLVGIDYKD       120
     KPDNARRFLG RYGNPFAAVG VDASGRAAIE WGVYGVPETF VIGRDGKIAY KLVGPITPDN       180
     IEKVLKPEIS KALAAPQS                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page