(data stored in ACNUC30630 zone)

EMBL: CP001096.PE208

CP001096.PE208       Location/Qualifiers
FT   CDS             229876..230403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0210"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bja:blr0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98770"
FT                   /db_xref="GOA:B3Q782"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q782"
FT                   /protein_id="ACE98770.1"
FT                   /translation="MSFGFRSAKLAMVAVVLAGASVLTAPRAEARPDLVVFRGDYSPGT
FT                   IVVRTGERRLYLVVEPGHAVRYPVGVGKAGKQWAGVTKIDGKFRNPAWAPPAEVKRDVP
FT                   TIPDVIPGGSPANPMGVAAMTLAGGEYAIHGTNRPQSIGGFVSYGCIRMLNDDITDLYE
FT                   RVPVGTQVVVMR"
     MSFGFRSAKL AMVAVVLAGA SVLTAPRAEA RPDLVVFRGD YSPGTIVVRT GERRLYLVVE        60
     PGHAVRYPVG VGKAGKQWAG VTKIDGKFRN PAWAPPAEVK RDVPTIPDVI PGGSPANPMG       120
     VAAMTLAGGE YAIHGTNRPQ SIGGFVSYGC IRMLNDDITD LYERVPVGTQ VVVMR            175
//

If you have problems or comments...

PBIL Back to PBIL home page