(data stored in ACNUC30630 zone)

EMBL: CP001096.PE216

CP001096.PE216       Location/Qualifiers
FT   CDS             complement(236887..237285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0218"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: bja:blr0512 succinate dehydrogenase
FT                   cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98778"
FT                   /db_xref="GOA:B3Q790"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q790"
FT                   /protein_id="ACE98778.1"
FT                   /translation="MTARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWW
FT                   LIACAAGPTAYANVQAFTGSWIGRLIVFGYTWSLMHHMLSGVRHFVWDLGYGFKTADRE
FT                   WLTWAALIGGIVLTVLLWVIAYSMGVAR"
     MTARIERPLS PHMQAYRWSL TMTMSIVHRA TGIALYSGTL LLAWWLIACA AGPTAYANVQ        60
     AFTGSWIGRL IVFGYTWSLM HHMLSGVRHF VWDLGYGFKT ADREWLTWAA LIGGIVLTVL       120
     LWVIAYSMGV AR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page