(data stored in ACNUC30630 zone)

EMBL: CP001096.PE23

CP001096.PE23        Location/Qualifiers
FT   CDS             complement(24176..24778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0023"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bja:blr0588
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98585"
FT                   /db_xref="GOA:B3Q5V6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V6"
FT                   /protein_id="ACE98585.1"
FT                   /translation="MTQPPPQFLFDFGSPNAFLAHEAIPAIEQRIGVKFDYVPVLLGGI
FT                   FKATNNKSPAETLAGIKNKREFLVVETERFLKRYAVKPYVWNPHFPVNTLNLMRAAVAA
FT                   QLEGVFEKYVEAAFHHMWVEPKKMDDLEVAAAALSSSGLDGKALLTRAQEPEVKAKLIA
FT                   NTEDAVQRGVFGSPTFFVGKEMFFGKEQLRDVEELYG"
     MTQPPPQFLF DFGSPNAFLA HEAIPAIEQR IGVKFDYVPV LLGGIFKATN NKSPAETLAG        60
     IKNKREFLVV ETERFLKRYA VKPYVWNPHF PVNTLNLMRA AVAAQLEGVF EKYVEAAFHH       120
     MWVEPKKMDD LEVAAAALSS SGLDGKALLT RAQEPEVKAK LIANTEDAVQ RGVFGSPTFF       180
     VGKEMFFGKE QLRDVEELYG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page