(data stored in ACNUC30630 zone)

EMBL: CP001096.PE238

CP001096.PE238       Location/Qualifiers
FT   CDS             complement(257510..258919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0240"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: nha:Nham_3584 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98800"
FT                   /db_xref="GOA:B3Q851"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q851"
FT                   /protein_id="ACE98800.1"
FT                   /translation="MSAKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAFE
FT                   GLRTAGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESAEQIAALAENARDFGITYYNEF
FT                   DKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKAKNMRVTVDGQLPDGVTAKDVILAIIGEIGTAGGTGYVLEYAGDAIRSLSMEGRMTV
FT                   CNMSIEGGARAGLIAPDAKAYEFLKGRPLAPKGEAWDAALRYWETLRSDDGAHFDHELK
FT                   LDAAALPPIVTWGTSPEDVISVTGRVPNPADIADEAKRLSKERALAYMGLTPGTKITDI
FT                   KIDRMFIGSCTNGRIEDLRAAAKVAEGKTVNANVNAIIVPGSGLVKEQAEAEGLDKIFI
FT                   KAGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAI
FT                   AGHFVDIRDWH"
     MSAKPTTLYD KIWNDHLVHE AEDGTCLLYI DRHLVHEVTS PQAFEGLRTA GRKVHAPEKT        60
     LAVVDHNVPT TDRSKPNPDP ESAEQIAALA ENARDFGITY YNEFDKRQGV VHVIGPEQGF       120
     TLPGTTIVCG DSHTSTHGAF GALAHGIGTS EVEHVLATQT LIQKKAKNMR VTVDGQLPDG       180
     VTAKDVILAI IGEIGTAGGT GYVLEYAGDA IRSLSMEGRM TVCNMSIEGG ARAGLIAPDA       240
     KAYEFLKGRP LAPKGEAWDA ALRYWETLRS DDGAHFDHEL KLDAAALPPI VTWGTSPEDV       300
     ISVTGRVPNP ADIADEAKRL SKERALAYMG LTPGTKITDI KIDRMFIGSC TNGRIEDLRA       360
     AAKVAEGKTV NANVNAIIVP GSGLVKEQAE AEGLDKIFIK AGFEWREPGC SMCLAMNPDK       420
     LAPEERCAST SNRNFEGRQG FKGRTHLVSP AMAAAAAIAG HFVDIRDWH                   469
//

If you have problems or comments...

PBIL Back to PBIL home page