(data stored in ACNUC30630 zone)

EMBL: CP001096.PE240

CP001096.PE240       Location/Qualifiers
FT   CDS             complement(259229..259618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0242"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: nha:Nham_3582 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98802"
FT                   /db_xref="GOA:B3Q853"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q853"
FT                   /protein_id="ACE98802.1"
FT                   /translation="MNLIQTLEKEQFDKLSAGKTIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKKQDRTAAVAAAE"
     MNLIQTLEKE QFDKLSAGKT IPEFGPGDTV IVNVKVVEGE RSRVQAYEGV CIGRSGGGIN        60
     ESFTVRKISY GEGVERVFPL LSPMIDSIKV VRRGKVRRAK LYYLRNLRGK SARIVEKKQD       120
     RTAAVAAAE                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page