(data stored in ACNUC30630 zone)

EMBL: CP001096.PE246

CP001096.PE246       Location/Qualifiers
FT   CDS             264152..265213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0248"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bra:BRADO0380 putative metallo-hydrolase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98808"
FT                   /db_xref="GOA:B3Q859"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q859"
FT                   /protein_id="ACE98808.1"
FT                   /translation="MSLITRRRLLATAAGLAATAGLSSLWISRMSYYQGPVTDHFDGTR
FT                   FFDPDGAPPKSFWEVMRWRFSHKPAQWPEWAPSPFADTPPPRVDGAGIRLVYVGHASWL
FT                   IQTAGLNVLIDPVWSKRVSPVSFAGPKRHNDPGVAFDRLPKIDVVLVSHGHYDHLDLAT
FT                   LSRLAATHRPRVITPLGNDLTMTAHDDSIRAEAYDWSDRVELNDRVAVTLVPTRHWTAR
FT                   GLFDRNRALWASFVLETPAGRIYVVCDSGYGDGRHFRRVRDAHAPLKLAILPIGAYEPR
FT                   WFMQDQHMNPADAVKALADCGAERALANHHGTFQLTDEAIDAPEQALYAALDADGVPRE
FT                   RFPVLKPGQVFEL"
     MSLITRRRLL ATAAGLAATA GLSSLWISRM SYYQGPVTDH FDGTRFFDPD GAPPKSFWEV        60
     MRWRFSHKPA QWPEWAPSPF ADTPPPRVDG AGIRLVYVGH ASWLIQTAGL NVLIDPVWSK       120
     RVSPVSFAGP KRHNDPGVAF DRLPKIDVVL VSHGHYDHLD LATLSRLAAT HRPRVITPLG       180
     NDLTMTAHDD SIRAEAYDWS DRVELNDRVA VTLVPTRHWT ARGLFDRNRA LWASFVLETP       240
     AGRIYVVCDS GYGDGRHFRR VRDAHAPLKL AILPIGAYEP RWFMQDQHMN PADAVKALAD       300
     CGAERALANH HGTFQLTDEA IDAPEQALYA ALDADGVPRE RFPVLKPGQV FEL              353
//

If you have problems or comments...

PBIL Back to PBIL home page