(data stored in ACNUC30630 zone)

EMBL: CP001096.PE262

CP001096.PE262       Location/Qualifiers
FT   CDS             complement(282424..282846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0264"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   cph:Cpha266_0672 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98824"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q875"
FT                   /protein_id="ACE98824.1"
FT                   /translation="MQIQRHRIELATTAPIQLIDITDQVRRFVTSSGIKDGLVTVSCLH
FT                   TTARINVNEREEKLERDMLTFLKRFVPRDGDYLHNLDPVDGRDNAHSHLIGLFMNSSET
FT                   IPVAKGTMVLGEWQSVFFIELDGPRERRGVELQIIG"
     MQIQRHRIEL ATTAPIQLID ITDQVRRFVT SSGIKDGLVT VSCLHTTARI NVNEREEKLE        60
     RDMLTFLKRF VPRDGDYLHN LDPVDGRDNA HSHLIGLFMN SSETIPVAKG TMVLGEWQSV       120
     FFIELDGPRE RRGVELQIIG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page