(data stored in ACNUC30630 zone)

EMBL: CP001096.PE268

CP001096.PE268       Location/Qualifiers
FT   CDS             289952..290149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0270"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   nha:Nham_0083 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98830"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q881"
FT                   /protein_id="ACE98830.1"
FT                   /translation="MSLSPSERPDTVDRKLLDILVCPVTKGPLEFDPARQELISRGAKL
FT                   AYPIRDGIPIMLPEEARKLG"
     MSLSPSERPD TVDRKLLDIL VCPVTKGPLE FDPARQELIS RGAKLAYPIR DGIPIMLPEE        60
     ARKLG                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page