(data stored in ACNUC30630 zone)

EMBL: CP001096.PE271

CP001096.PE271       Location/Qualifiers
FT   CDS             complement(292654..293487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce3213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98833"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q884"
FT                   /protein_id="ACE98833.1"
FT                   /translation="MLQRLVKATNQWMPTAMAFHCCRILASRPPRAEVSAAEQAALAQA
FT                   SRLFELDWSNDAAWSWGSGPTVVLIHGWGGRAAQMAPLAVELARSGLRAVAFDVAGHGE
FT                   SAEPSAGWEYSIRDIAKVSRQLGSVAGYVGHSAGGLSLMAARRIHGLSPAKYVCVCAPS
FT                   HPYPPVRGLAQRLDPRPSVLQRYRTYLGAQFQTDWRSLEAGAAYLGAGDDLLLCYDRKD
FT                   RFVDPDDGNRIHALCPGSRLLTSDAYGHTRILRATEVMREIAKFLNDEASRIAAA"
     MLQRLVKATN QWMPTAMAFH CCRILASRPP RAEVSAAEQA ALAQASRLFE LDWSNDAAWS        60
     WGSGPTVVLI HGWGGRAAQM APLAVELARS GLRAVAFDVA GHGESAEPSA GWEYSIRDIA       120
     KVSRQLGSVA GYVGHSAGGL SLMAARRIHG LSPAKYVCVC APSHPYPPVR GLAQRLDPRP       180
     SVLQRYRTYL GAQFQTDWRS LEAGAAYLGA GDDLLLCYDR KDRFVDPDDG NRIHALCPGS       240
     RLLTSDAYGH TRILRATEVM REIAKFLNDE ASRIAAA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page