(data stored in ACNUC30630 zone)

EMBL: CP001096.PE280

CP001096.PE280       Location/Qualifiers
FT   CDS             300351..302819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0282"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: bja:blr0616 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98842"
FT                   /db_xref="GOA:B3Q893"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q893"
FT                   /protein_id="ACE98842.1"
FT                   /translation="MSMPAIERAFPLVGHLPPSVREVLARRLRELAGFGLIALAAVAAA
FT                   ALATWSVQDPSLSHATSRRIHNLLGYPGAIGADLAMQILGLGAIGLLMPVAVWGWRMLN
FT                   HRPFDRTALRMGAWFLCTIFAAGFASSFPHDTAWPLPTGLGGVVGDALVRAPSLVFGPG
FT                   LIFRVILSFILGAAVLATFLIAGGFGSREREPDEATSDEDLPLEDEEESDRGSVSLGWL
FT                   VHALLSAKARLWRLAKLSYQGLVSSAPATGKQGFERQEPRLGGRTAPPIAPEADHHDDY
FT                   EPEPVEEIEDEDDEEEAPPVSRAPRKKAAPKPVAKKARFDLPSVNVLSAPKASDRQPLS
FT                   KSELEANSRALEGVLQDFGVRGEIIKASPGPVVTLYELEPAPGIKSSRVIGLSDDIARS
FT                   MSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDTNETVHKLPLCLGKNIGGES
FT                   IIVDLARMPHLLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDGI
FT                   PHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLGEAKAKGEELTR
FT                   TVHTGFDKETGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMARA
FT                   AGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLY
FT                   MAGGGRISRVHGPFVSDEEVEKVVKHLKAQGAPEYLEAVTAEEPSEEDGAVFDATGMGG
FT                   DGGGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGQANHAGKRE
FT                   ILVAEEDSNF"
     MSMPAIERAF PLVGHLPPSV REVLARRLRE LAGFGLIALA AVAAAALATW SVQDPSLSHA        60
     TSRRIHNLLG YPGAIGADLA MQILGLGAIG LLMPVAVWGW RMLNHRPFDR TALRMGAWFL       120
     CTIFAAGFAS SFPHDTAWPL PTGLGGVVGD ALVRAPSLVF GPGLIFRVIL SFILGAAVLA       180
     TFLIAGGFGS REREPDEATS DEDLPLEDEE ESDRGSVSLG WLVHALLSAK ARLWRLAKLS       240
     YQGLVSSAPA TGKQGFERQE PRLGGRTAPP IAPEADHHDD YEPEPVEEIE DEDDEEEAPP       300
     VSRAPRKKAA PKPVAKKARF DLPSVNVLSA PKASDRQPLS KSELEANSRA LEGVLQDFGV       360
     RGEIIKASPG PVVTLYELEP APGIKSSRVI GLSDDIARSM SALSARVAVV PGRNAIGIEL       420
     PNAHREKVYL RELLSVKDTN ETVHKLPLCL GKNIGGESII VDLARMPHLL IAGTTGSGKS       480
     VAINTMILSL VYRLRPDQCR LIMVDPKMLE LSVYDGIPHL LTPVVTDPKK AVVALKWAVR       540
     EMEERYKRMA KLGVRNIDGY NTRLGEAKAK GEELTRTVHT GFDKETGKAI YEEEKLDLEP       600
     LPYIVIIVDE MADLMMVAGK DIEGAVQRLA QMARAAGLHV ILATQRPSVD VITGTIKANF       660
     PTRISFQVTS KIDSRTILGE MGAEQLLGQG DMLYMAGGGR ISRVHGPFVS DEEVEKVVKH       720
     LKAQGAPEYL EAVTAEEPSE EDGAVFDATG MGGDGGGDLF QQAVAIVKRD RKASTSYIQR       780
     RLQIGYNRAA SLMERMELEG IVGQANHAGK REILVAEEDS NF                          822
//

If you have problems or comments...

PBIL Back to PBIL home page