(data stored in ACNUC30630 zone)

EMBL: CP001096.PE284

CP001096.PE284       Location/Qualifiers
FT   CDS             complement(305420..306106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0286"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bja:bll0620 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98846"
FT                   /db_xref="GOA:B3Q897"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q897"
FT                   /protein_id="ACE98846.1"
FT                   /translation="MPNARKILIVDDDNDLRDALVEQLSLHEEFEASAVDTGAKGVQTA
FT                   KALSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRAGQAPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIERDAANPEILVTEAG
FT                   GYKLVP"
     MPNARKILIV DDDNDLRDAL VEQLSLHEEF EASAVDTGAK GVQTAKALSP DLVLMDVGLP        60
     DTDGREVVRS LRKGGFKAPI IMLTGHDTDS DTILGLESGA NDYVAKPFRF AVLLARIRAQ       120
     LRQHEASEDA VFTVGPYSFR PGSKMLTGAN AKKVRLTEKE TAILRFLYRA GQAPVSRETL       180
     LQEVWGYNSG VTTHTLETHI YRLRQKIERD AANPEILVTE AGGYKLVP                    228
//

If you have problems or comments...

PBIL Back to PBIL home page