(data stored in ACNUC30630 zone)

EMBL: CP001096.PE290

CP001096.PE290       Location/Qualifiers
FT   CDS             312862..313893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0292"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: bja:blr0629 DNA polymerase
FT                   III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98852"
FT                   /db_xref="GOA:B3Q8A3"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A3"
FT                   /protein_id="ACE98852.1"
FT                   /translation="MVALRGKDATSFLARPDPGRPIVLLYGPDAGLVRERADALIAASL
FT                   DDPKDPFALVRLDGDELAAEPSRLVDEALAIPMFGGRRAIRVRAGSRSFVAGVEALITS
FT                   PPRECRIVIEAGDIKPDNALRKACEKAATGAVAIGCYPDAEADIARLIDDELRGSNLQI
FT                   AKDARAVLTTLLGGDRQASRNELRKLALYAHGKGEVTLDDVITCVSDASDLKLDAIVDA
FT                   AFSGKPVVVETEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLVVEGGTPAAVVLDSGFP
FT                   RLHFSRKAAAETALRNLSTTRLAQIIEQLASAALETRRQATLGAAIAQRTLLSIAVSAR
FT                   RRS"
     MVALRGKDAT SFLARPDPGR PIVLLYGPDA GLVRERADAL IAASLDDPKD PFALVRLDGD        60
     ELAAEPSRLV DEALAIPMFG GRRAIRVRAG SRSFVAGVEA LITSPPRECR IVIEAGDIKP       120
     DNALRKACEK AATGAVAIGC YPDAEADIAR LIDDELRGSN LQIAKDARAV LTTLLGGDRQ       180
     ASRNELRKLA LYAHGKGEVT LDDVITCVSD ASDLKLDAIV DAAFSGKPVV VETEFAKAMV       240
     AGTYPGQIIL AAQRHAAFLH KTSLVVEGGT PAAVVLDSGF PRLHFSRKAA AETALRNLST       300
     TRLAQIIEQL ASAALETRRQ ATLGAAIAQR TLLSIAVSAR RRS                         343
//

If you have problems or comments...

PBIL Back to PBIL home page