(data stored in ACNUC30630 zone)

EMBL: CP001096.PE291

CP001096.PE291       Location/Qualifiers
FT   CDS             complement(314155..315045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0293"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: nwi:Nwi_0094 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98853"
FT                   /db_xref="GOA:B3Q8A4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A4"
FT                   /protein_id="ACE98853.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEATQVERPRAQRKVPIEFIKANP
FT                   RNPRRTFTDAELGELSDSIKQHGVIQPIVVRPVKGSADRYEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDALALEIAIVENVQREDLNPLEEALGYQALAAEFNRSQEEIAKIVGKSRS
FT                   HVANMMRLIKLPDDVKSLIASGELTAGHARALIGLPDPSTIAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRATASAKSVKDADTLALEKRLSDALGMKVTIDDHEGTGAVQIRYAD
FT                   LDQLDDIIRRLEVGG"
     MADEHRSRLG RGLASLIGDV GGEATQVERP RAQRKVPIEF IKANPRNPRR TFTDAELGEL        60
     SDSIKQHGVI QPIVVRPVKG SADRYEIIAG ERRWRAAQRA GLHEVPIVPV DVSDALALEI       120
     AIVENVQRED LNPLEEALGY QALAAEFNRS QEEIAKIVGK SRSHVANMMR LIKLPDDVKS       180
     LIASGELTAG HARALIGLPD PSTIAKRIVA EGLNVRQTEA LAHEEGVPER KPQKPRATAS       240
     AKSVKDADTL ALEKRLSDAL GMKVTIDDHE GTGAVQIRYA DLDQLDDIIR RLEVGG           296
//

If you have problems or comments...

PBIL Back to PBIL home page