(data stored in ACNUC30630 zone)

EMBL: CP001096.PE293

CP001096.PE293       Location/Qualifiers
FT   CDS             complement(316100..316771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0295"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: bra:BRADO0194 glucose
FT                   inhibited division protein B; methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98855"
FT                   /db_xref="GOA:B3Q8A6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A6"
FT                   /protein_id="ACE98855.1"
FT                   /translation="MQRAARPLVSVSDLDADKAAALKLIPIPSALEARLDAYVALLQQW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLVSLMPHARRWLDFGSGGGFPGVVLACAMADVGG
FT                   HVTLVERIAKKAAFLREALRVAGAPGTVVLADIGDNVDRFPQALDCITARAVAPLHQLI
FT                   GFAEPLMTPGITKALFLKGQDVDAELTESTKYWKFQPKLHASLTGGQGWIVEIDHIERR
FT                   T"
     MQRAARPLVS VSDLDADKAA ALKLIPIPSA LEARLDAYVA LLQQWQAKTN LVAPSTLPQL        60
     WTRHVADSLQ LVSLMPHARR WLDFGSGGGF PGVVLACAMA DVGGHVTLVE RIAKKAAFLR       120
     EALRVAGAPG TVVLADIGDN VDRFPQALDC ITARAVAPLH QLIGFAEPLM TPGITKALFL       180
     KGQDVDAELT ESTKYWKFQP KLHASLTGGQ GWIVEIDHIE RRT                         223
//

If you have problems or comments...

PBIL Back to PBIL home page