(data stored in ACNUC30630 zone)

EMBL: CP001096.PE300

CP001096.PE300       Location/Qualifiers
FT   CDS             324352..324951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0302"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: nha:Nham_0114 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98862"
FT                   /db_xref="GOA:B3Q8B3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B3"
FT                   /protein_id="ACE98862.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAKLFAEAGVPVYDADATVHKIYENEAVP
FT                   AIEAAFPGTTVGGKVDRALLSAKVVHDPAAMKRLEGIVHPMLRAHHQQFLDDAESSGAP
FT                   VAVVDVPLLFETGGEKRVDAVVVVTTSPEVQRERILARDNMTPEKLDAILARQMPDAEK
FT                   RKRADFVVDTSNGLDPVRLQIREILEAAAKMPRRRD"
     MLVLGLTGSI GMGKSTTAKL FAEAGVPVYD ADATVHKIYE NEAVPAIEAA FPGTTVGGKV        60
     DRALLSAKVV HDPAAMKRLE GIVHPMLRAH HQQFLDDAES SGAPVAVVDV PLLFETGGEK       120
     RVDAVVVVTT SPEVQRERIL ARDNMTPEKL DAILARQMPD AEKRKRADFV VDTSNGLDPV       180
     RLQIREILEA AAKMPRRRD                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page