(data stored in ACNUC30630 zone)

EMBL: CP001096.PE303

CP001096.PE303       Location/Qualifiers
FT   CDS             326702..327409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0305"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bja:blr0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98865"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B6"
FT                   /protein_id="ACE98865.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPG
FT                   KQDNNVVSMPGTVIDQAPMAPNADVVPPSDRWKGIAEPDSELEHGLNAIAQNDSSFDAQ
FT                   HFITGAKSAYEMIVMAFANGDRRSLRDLLSSEVYESFDAAIKDREKNDLKVETRFVSIE
FT                   KAELISAELRDRTAMLTLKFVSQMISATRDKTGAVVDGSPDKVVDITDVWTFARDTSSR
FT                   DPNWKLVGTGSGT"
     MDIYTIIFLA LAVFIFLRLR NVLGQRTGSE RPPFDRAAAR DMIPGKQDNN VVSMPGTVID        60
     QAPMAPNADV VPPSDRWKGI AEPDSELEHG LNAIAQNDSS FDAQHFITGA KSAYEMIVMA       120
     FANGDRRSLR DLLSSEVYES FDAAIKDREK NDLKVETRFV SIEKAELISA ELRDRTAMLT       180
     LKFVSQMISA TRDKTGAVVD GSPDKVVDIT DVWTFARDTS SRDPNWKLVG TGSGT            235
//

If you have problems or comments...

PBIL Back to PBIL home page