(data stored in ACNUC30630 zone)

EMBL: CP001096.PE305

CP001096.PE305       Location/Qualifiers
FT   CDS             328886..329470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0307"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: bja:blr0644
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98867"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B8"
FT                   /protein_id="ACE98867.1"
FT                   /translation="MKRIIPPLDPPMSRRKRSLTEDERALWDGVARQIKPLRGRPRLIK
FT                   VEIADPQALVPAIKPAPVAPPQPLKRTAKPSLPTAPPPLTPLGRRERAHLSRGRKDIDA
FT                   RIDLHGMTQARAHHALLYFLQRASHDGLGFVLVITGKGKSGDTERGVLRRQVPQWLALP
FT                   EFRAYVVGFDEAHIGHGGEGALYVRVRRARG"
     MKRIIPPLDP PMSRRKRSLT EDERALWDGV ARQIKPLRGR PRLIKVEIAD PQALVPAIKP        60
     APVAPPQPLK RTAKPSLPTA PPPLTPLGRR ERAHLSRGRK DIDARIDLHG MTQARAHHAL       120
     LYFLQRASHD GLGFVLVITG KGKSGDTERG VLRRQVPQWL ALPEFRAYVV GFDEAHIGHG       180
     GEGALYVRVR RARG                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page