(data stored in ACNUC30630 zone)

EMBL: CP001096.PE312

CP001096.PE312       Location/Qualifiers
FT   CDS             334301..335038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0314"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: bbt:BBta_0145
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98874"
FT                   /db_xref="GOA:B3Q950"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q950"
FT                   /protein_id="ACE98874.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAQSFAAQGFQ
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKVVSMPVQLGGGIRDLKTIEAWLSKGIARVIIGT
FT                   AAVRDPALVKEAAKAFPGRVAVGLDARDGNVAVEGWAESSQVTALDIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVRTLLSPRAKKLEGAIAG
FT                   RALYDGRLDPTEALALIGAAKAA"
     MILFPAIDLK NGQCVRLEQG DMARATVFNL DPAAQAQSFA AQGFQYLHVV DLDGAFAGKP        60
     MNAQAVEAML KVVSMPVQLG GGIRDLKTIE AWLSKGIARV IIGTAAVRDP ALVKEAAKAF       120
     PGRVAVGLDA RDGNVAVEGW AESSQVTALD IAQRFEDAGV AAIIFTDIAR DGLLKGINWD       180
     ATIALAEAIS IPVIASGGLA SIEDVRTLLS PRAKKLEGAI AGRALYDGRL DPTEALALIG       240
     AAKAA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page