(data stored in ACNUC30630 zone)

EMBL: CP001096.PE325

CP001096.PE325       Location/Qualifiers
FT   CDS             346656..347855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0327"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: nha:Nham_0148 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98887"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q963"
FT                   /protein_id="ACE98887.1"
FT                   /translation="MASLHDPHTKPLRTTRRTALGLLLGAPLLSACSGVQQSLSDQFGQ
FT                   QQPAAGPAQQPAAVGNGRVKVGLVLPLSAPGNAGLAAQSMKNAAEMALAEFRNPDVQLL
FT                   IKDDAGNPTGAQTATQQALDEGAEIILGPLFAQSVPAAAQAARARGVSVIAFSTDSSVA
FT                   GRGVFLLSFLPESDVNRIIGYAGSIGKRSYAALLPENAYGAVVEAAFKQITSQKGGRIV
FT                   AFEKYGADRAGPARTIAASLASADALLLADDGDALAAVADALGAAGADLKRVQLLGTGL
FT                   WDNPRVFATQALQGGLFAAPDPSGFRAFSGRYRARYGQDPVRTATLAYDGVALVAALAR
FT                   TQGPQRFSAETLTNPSGFAGIDGLFRFRADGTNERGLAVMKVASGGAQAVAGPPKSFGA
FT                   "
     MASLHDPHTK PLRTTRRTAL GLLLGAPLLS ACSGVQQSLS DQFGQQQPAA GPAQQPAAVG        60
     NGRVKVGLVL PLSAPGNAGL AAQSMKNAAE MALAEFRNPD VQLLIKDDAG NPTGAQTATQ       120
     QALDEGAEII LGPLFAQSVP AAAQAARARG VSVIAFSTDS SVAGRGVFLL SFLPESDVNR       180
     IIGYAGSIGK RSYAALLPEN AYGAVVEAAF KQITSQKGGR IVAFEKYGAD RAGPARTIAA       240
     SLASADALLL ADDGDALAAV ADALGAAGAD LKRVQLLGTG LWDNPRVFAT QALQGGLFAA       300
     PDPSGFRAFS GRYRARYGQD PVRTATLAYD GVALVAALAR TQGPQRFSAE TLTNPSGFAG       360
     IDGLFRFRAD GTNERGLAVM KVASGGAQAV AGPPKSFGA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page