(data stored in ACNUC30630 zone)

EMBL: CP001096.PE327

CP001096.PE327       Location/Qualifiers
FT   CDS             348306..348635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_4576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98889"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q965"
FT                   /protein_id="ACE98889.1"
FT                   /translation="MTVSLPAPIEAYFVASNARAVQDVAAAFAADAEVRDEGKIHRGRE
FT                   AIAAWKRAALGKYQMQMEPLTIERAAQTAIVTARVAGDFPGSPVRLTYRFGLGEDGITS
FT                   LEIGA"
     MTVSLPAPIE AYFVASNARA VQDVAAAFAA DAEVRDEGKI HRGREAIAAW KRAALGKYQM        60
     QMEPLTIERA AQTAIVTARV AGDFPGSPVR LTYRFGLGED GITSLEIGA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page