(data stored in ACNUC30630 zone)

EMBL: CP001096.PE334

CP001096.PE334       Location/Qualifiers
FT   CDS             354525..356420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0336"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bbt:BBta_0191 chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98896"
FT                   /db_xref="GOA:B3Q972"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q972"
FT                   /protein_id="ACE98896.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKSAKVIENAEGMRTTPSIVAITDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKGLVPYKIVKASNGDAWVE
FT                   ADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKAKTGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVNYLADEFQKEQGIDLRKDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEISEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEAN
FT                   AAEDKKRREAVDAKNHADALVHSTEKALAEHGSKVDESERRSIEDALSDLREALKGDDA
FT                   EAIKAKSNTLAQASMKLGEAMYKQAEAAGGAQQAGKDDVVDAEFTEVDDDKKKSA"
     MGKVIGIDLG TTNSCVAVMD GKSAKVIENA EGMRTTPSIV AITDDGERLV GQPAKRQAVT        60
     NPERTFFAVK RLIGRRYDDP MVEKDKGLVP YKIVKASNGD AWVEADGKTY SPSQVSAFIL       120
     QKMKETAEAH LGQKVDQAVI TVPAYFNDAQ RQATKDAGKI AGLEVLRIIN EPTAAALAYG       180
     LDKAKTGTIA VYDLGGGTFD VSILEIGDGV FEVKSTNGDT FLGGEDFDMR LVNYLADEFQ       240
     KEQGIDLRKD KLALQRLKEA AEKAKIELSS TTQTEINLPF ITADQSGPKH LTMKLTRAKF       300
     EALVDDLVQK TIEPCRKALK DAGLTAGEIS EVVLVGGMTR MPKVQEVVKQ LFGKEPHKGV       360
     NPDEVVAIGA AIQAGVLQGD VKDVLLLDVT PLSLGIETLG GVFTRIIDRN TTIPTKKSQV       420
     FSTAEDNQNA VTIRVFQGER EMAADNKMLG QFDLMGIPPA PRGMPQIEVT FDIDANGIVN       480
     VSAKDKATGK EQQIRIQASG GLSDSEIDKM VKDAEANAAE DKKRREAVDA KNHADALVHS       540
     TEKALAEHGS KVDESERRSI EDALSDLREA LKGDDAEAIK AKSNTLAQAS MKLGEAMYKQ       600
     AEAAGGAQQA GKDDVVDAEF TEVDDDKKKS A                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page