(data stored in ACNUC30630 zone)

EMBL: CP001096.PE347

CP001096.PE347       Location/Qualifiers
FT   CDS             complement(368431..369174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0349"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   nwi:Nwi_0060 CysZ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98909"
FT                   /db_xref="GOA:B3Q985"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q985"
FT                   /protein_id="ACE98909.1"
FT                   /translation="MLDAAIKALTQILSPPMRSILWRSVGFALALIAVAAIGLQRLLSW
FT                   AATSSELWAEAALGGFQTPLYILSWVLSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVERESYPHEAPGVALPIGLATWETVKTALLTILVYLVALPFLFVAGAGAIVFFVATA
FT                   WLLGREYFELAAMRFRTAPEAKAMRRDNATTVFIGGLIIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRLSGSRPEVLAPDQRSMRR"
     MLDAAIKALT QILSPPMRSI LWRSVGFALA LIAVAAIGLQ RLLSWAATSS ELWAEAALGG        60
     FQTPLYILSW VLSIAAGLGI VVGAVFLMPA VTSLVAGIFV DEAAEHVERE SYPHEAPGVA       120
     LPIGLATWET VKTALLTILV YLVALPFLFV AGAGAIVFFV ATAWLLGREY FELAAMRFRT       180
     APEAKAMRRD NATTVFIGGL IIAAFVSIPI VNLATPLFGM AFMVHLHKRL SGSRPEVLAP       240
     DQRSMRR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page