(data stored in ACNUC30630 zone)

EMBL: CP001096.PE369

CP001096.PE369       Location/Qualifiers
FT   CDS             complement(394333..395232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0371"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: bja:blr7337 RNA polymerase factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98931"
FT                   /db_xref="GOA:B3Q9A7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A7"
FT                   /protein_id="ACE98931.1"
FT                   /translation="MARAATLPILNGESGLARYLAEIRKFPMLEPQQEYMLAKRWREHG
FT                   DRDAAHQLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPEKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDLHPDQVKLIA
FT                   TRLGVTEQDVVDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPSQEAVMAEHEELDQ
FT                   RRAALNGAIQVLNPRERRIFEARRLADEPMTLEDLASEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEQAALEAAH"
     MARAATLPIL NGESGLARYL AEIRKFPMLE PQQEYMLAKR WREHGDRDAA HQLVTSHLRL        60
     VAKIAMGYRG YGLPISEVVS EGNVGLMQAV KRFEPEKGFR LATYAMWWIK ASIQEYILRS       120
     WSLVKMGTTA NQKKLFFNLR KAKSKISALD EGDLHPDQVK LIATRLGVTE QDVVDMNRRL       180
     GGDASLNAPI RDDGEPGEWQ DWLVDQSPSQ EAVMAEHEEL DQRRAALNGA IQVLNPRERR       240
     IFEARRLADE PMTLEDLASE FGVSRERVRQ IEVRAFEKVQ SAVKGTIARQ EQAALEAAH        299
//

If you have problems or comments...

PBIL Back to PBIL home page