(data stored in ACNUC30630 zone)

EMBL: CP001096.PE371

CP001096.PE371       Location/Qualifiers
FT   CDS             396501..396836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98933"
FT                   /db_xref="GOA:B3Q9A9"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A9"
FT                   /protein_id="ACE98933.1"
FT                   /translation="MTDTATPDPTPEQAALFARVRRMMLIAGLTTTLAVAAVLIAIGYK
FT                   LFRAEGSAPAATEHTLRLPKGARVVSTASAGDYVVVTLDIGGATELRTFEAKTLKPTGR
FT                   LTFATEP"
     MTDTATPDPT PEQAALFARV RRMMLIAGLT TTLAVAAVLI AIGYKLFRAE GSAPAATEHT        60
     LRLPKGARVV STASAGDYVV VTLDIGGATE LRTFEAKTLK PTGRLTFATE P                111
//

If you have problems or comments...

PBIL Back to PBIL home page