(data stored in ACNUC30630 zone)

EMBL: CP001096.PE378

CP001096.PE378       Location/Qualifiers
FT   CDS             403814..404536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0380"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: nha:Nham_1929 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98940"
FT                   /db_xref="GOA:B3Q9B6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B6"
FT                   /protein_id="ACE98940.1"
FT                   /translation="MTSPASDLPPLSGRSFAVLRELMVERQIAARGLHDPRVLAAMRKV
FT                   PREAFLPEPMRDLAYEDAPVPIAAEQTMSQPYIVALMVEALLLQGSDNVLEIGAGSGYA
FT                   AAVLGEIAGHVTTVERIATLADAAAAKLAELGYGHVDVHRSDGTRGWAAAAPYDAIVVA
FT                   AGGPQVPESLKAQLKIGGRLVMPVGANQQAQELVRLTRLGEADFKREHLGDVRFVPLLG
FT                   SEGWQQPEPAGRTAREKG"
     MTSPASDLPP LSGRSFAVLR ELMVERQIAA RGLHDPRVLA AMRKVPREAF LPEPMRDLAY        60
     EDAPVPIAAE QTMSQPYIVA LMVEALLLQG SDNVLEIGAG SGYAAAVLGE IAGHVTTVER       120
     IATLADAAAA KLAELGYGHV DVHRSDGTRG WAAAAPYDAI VVAAGGPQVP ESLKAQLKIG       180
     GRLVMPVGAN QQAQELVRLT RLGEADFKRE HLGDVRFVPL LGSEGWQQPE PAGRTAREKG       240
//

If you have problems or comments...

PBIL Back to PBIL home page