(data stored in ACNUC30630 zone)

EMBL: CP001096.PE388

CP001096.PE388       Location/Qualifiers
FT   CDS             complement(415906..416148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98950"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C6"
FT                   /protein_id="ACE98950.1"
FT                   /translation="MVDRPRDLPRDLATRMAQRSRPADGFLRETFVLPRPAARAKAKEF
FT                   LEAWPKAAYMSSVESWRELPGDTIEFTMRRLPSAD"
     MVDRPRDLPR DLATRMAQRS RPADGFLRET FVLPRPAARA KAKEFLEAWP KAAYMSSVES        60
     WRELPGDTIE FTMRRLPSAD                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page