(data stored in ACNUC30630 zone)

EMBL: CP001096.PE400

CP001096.PE400       Location/Qualifiers
FT   CDS             complement(430492..431067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98962"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D8"
FT                   /protein_id="ACE98962.1"
FT                   /translation="MIMRRMLIAALAGSLMVAAGNAAVAREAKGKPAATPAAASGGGEP
FT                   TLIGQFGSWGAYTASPGGKKVCFALAKPSSSKTTPPNRPRDPAYAFISTRPSEKVVNEV
FT                   SVMVGYPLKPGSESAIEVAGSSFAMYTQGDGIWIKNAAEEERLVEAMRRGAEITVKGVS
FT                   AKGTASTDVFSLKGLAQALDKVAQACGS"
     MIMRRMLIAA LAGSLMVAAG NAAVAREAKG KPAATPAAAS GGGEPTLIGQ FGSWGAYTAS        60
     PGGKKVCFAL AKPSSSKTTP PNRPRDPAYA FISTRPSEKV VNEVSVMVGY PLKPGSESAI       120
     EVAGSSFAMY TQGDGIWIKN AAEEERLVEA MRRGAEITVK GVSAKGTAST DVFSLKGLAQ       180
     ALDKVAQACG S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page