(data stored in ACNUC30630 zone)

EMBL: CP001096.PE401

CP001096.PE401       Location/Qualifiers
FT   CDS             complement(431221..432057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0403"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bja:bll0527 hypothetical
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98963"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D9"
FT                   /protein_id="ACE98963.1"
FT                   /translation="MFEAGLLANRRILITGGGSGLGAAMAARFAELGASLVLCGRRAEV
FT                   LQETAEQLRSHGSQVDTIVCDVRDPQAVEAMLDEIWRVAPLDVLVNNAAATFIAQTERL
FT                   SARAADAILAPTLHGAMYCTLGAGRRWIDGEHAGVVLSILSTSTITGRAFTVPSAMAKS
FT                   AVLAMTKSLAVEWGPKQIRLVAIAPGAFPTAGATAQLRPDGRSADPADRVPLGRVGRHA
FT                   ELANLASFLISDQAGYITGEMVVQDGGTHLRSSGAEDLLQWNDQQWSAHRAGRAKS"
     MFEAGLLANR RILITGGGSG LGAAMAARFA ELGASLVLCG RRAEVLQETA EQLRSHGSQV        60
     DTIVCDVRDP QAVEAMLDEI WRVAPLDVLV NNAAATFIAQ TERLSARAAD AILAPTLHGA       120
     MYCTLGAGRR WIDGEHAGVV LSILSTSTIT GRAFTVPSAM AKSAVLAMTK SLAVEWGPKQ       180
     IRLVAIAPGA FPTAGATAQL RPDGRSADPA DRVPLGRVGR HAELANLASF LISDQAGYIT       240
     GEMVVQDGGT HLRSSGAEDL LQWNDQQWSA HRAGRAKS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page