(data stored in ACNUC30630 zone)

EMBL: CP001096.PE416

CP001096.PE416       Location/Qualifiers
FT   CDS             complement(450309..450635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0418"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   nwi:Nwi_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98978"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QA92"
FT                   /protein_id="ACE98978.1"
FT                   /translation="MAEAWRYSAQGVAVAVRVTPRGGRDDIDGLETLSDGRPVVKVRVR
FT                   AIADGGEANRAVTELLAKAVGVPKRNVRLLSGATSRQKQIAIDGDPKQLGEALRRLVAA
FT                   KPAE"
     MAEAWRYSAQ GVAVAVRVTP RGGRDDIDGL ETLSDGRPVV KVRVRAIADG GEANRAVTEL        60
     LAKAVGVPKR NVRLLSGATS RQKQIAIDGD PKQLGEALRR LVAAKPAE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page