(data stored in ACNUC30630 zone)

EMBL: CP001096.PE42

CP001096.PE42        Location/Qualifiers
FT   CDS             46773..47558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0042"
FT                   /product="conserved hypothetical protein, putative
FT                   alpha/beta hydrolase superfamily"
FT                   /note="KEGG: bra:BRADO0132 conserved hypothetical protein,
FT                   putative alpha/beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98604"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X5"
FT                   /protein_id="ACE98604.1"
FT                   /translation="MTKSPEPAPDFVTVGDGAPARRIAVRARPGASPGLFWLGGFNSDM
FT                   TGTKATALDQWAEARGRACVRFDYSGHGESSGSFADGTIGRWLEESLAVFDAYARGPQI
FT                   VVGSSMGGWMALLLARALRRRGGDAAAKLAGLVLIAPAPDFTEALMWKGFSLEIRAEIE
FT                   TKGVWHRPSEYGEPYPITKALIEDGRNHLVLDGMIEVGCPVRILQGKQDEDVPWRHAFE
FT                   LAERLPTDDVVLTMIQDGDHRLSRPQDIARMLAAVEELG"
     MTKSPEPAPD FVTVGDGAPA RRIAVRARPG ASPGLFWLGG FNSDMTGTKA TALDQWAEAR        60
     GRACVRFDYS GHGESSGSFA DGTIGRWLEE SLAVFDAYAR GPQIVVGSSM GGWMALLLAR       120
     ALRRRGGDAA AKLAGLVLIA PAPDFTEALM WKGFSLEIRA EIETKGVWHR PSEYGEPYPI       180
     TKALIEDGRN HLVLDGMIEV GCPVRILQGK QDEDVPWRHA FELAERLPTD DVVLTMIQDG       240
     DHRLSRPQDI ARMLAAVEEL G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page